PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK26618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 196aa    MW: 22746.5 Da    PI: 9.5352
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK26618.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.45.5e-5761331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v s +++
  PK26618.1   6 LPPGFRFHPTDEELVAYYLDRKITGQTIEL-EIIPEVDLYKCEPWDLPeKsYLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVQS-QRR 103
                79****************************.99**************94345566888*************************************9.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kktLv+y+grap+g +t+Wvmheyrl
  PK26618.1 104 PVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                ****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.19E-643158IPR003441NAC domain
PROSITE profilePS5100560.8456158IPR003441NAC domain
PfamPF023651.3E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKITG QTIELEIIPE VDLYKCEPWD LPEKSYLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVQS QRRPVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLLDDSLGG TVSSTLKDSY ALCRVFKKTI QIPKCNKNEE NPDNNNINGR  180
NNTEKDNQST ALGIIX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-59115812165NO APICAL MERISTEM PROTEIN
1ut4_B2e-59115812165NO APICAL MERISTEM PROTEIN
1ut7_A2e-59115812165NO APICAL MERISTEM PROTEIN
1ut7_B2e-59115812165NO APICAL MERISTEM PROTEIN
3swm_A2e-59115815168NAC domain-containing protein 19
3swm_B2e-59115815168NAC domain-containing protein 19
3swm_C2e-59115815168NAC domain-containing protein 19
3swm_D2e-59115815168NAC domain-containing protein 19
3swp_A2e-59115815168NAC domain-containing protein 19
3swp_B2e-59115815168NAC domain-containing protein 19
3swp_C2e-59115815168NAC domain-containing protein 19
3swp_D2e-59115815168NAC domain-containing protein 19
4dul_A2e-59115812165NAC domain-containing protein 19
4dul_B2e-59115812165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010092473.11e-120NAC domain-containing protein 78
SwissprotQ9FFI56e-88NAC86_ARATH; NAC domain-containing protein 86
TrEMBLW9RD251e-120W9RD25_9R
STRINGVIT_19s0085g00950.t011e-109(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.14e-97NAC domain containing protein 20